Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L68 (MIMI_L68)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L68 (MIMI_L68) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Uncharacterized protein L68

UniProt

Q5UPE7

Expression Region

1-241

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYFSIIKITMITEIYFQYVIYILCFGVLLLLKSESDRLLWLHLVSILVGLIANYEMKFN VLFAMFHSAVHNLWPFLKNTGYDNTEKSVYDVICHTIMVVICYHQICYTENAVTNNYYTF HLFSVMIIIGALFNCVVSGKAIGSNDRFLHSLFEYTTIFQALSTGYWVATMLWYHHLDNI HFYSHWIIWIGLMTINWFVYKFYPNLVGISMRYKYVEAVFIVCTWYSGIISSPLIKYINV Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NG2 (4D1) AC
sc-47718 AC 500 µg/mL - 25% ag

NG2 (4D1) AC

Sign In for Pricing
View Details
PTPLAD1 Rabbit Polyclonal Antibody (BF405)
orb2381435 100 µL

PTPLAD1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Mouse Monoclonal CD161 Antibody (10/78) [HRP]
NB100-65297H 0.1 mL

Mouse Monoclonal CD161 Antibody (10/78) [HRP]

Sign In for Pricing
View Details
Recombinant human CD39L3/ENTPD3 protein
ATGP3498-020 20 µg

Recombinant human CD39L3/ENTPD3 protein

Sign In for Pricing
View Details
UBE2Z siRNA (h)
sc-93728 10 µM

UBE2Z siRNA (h)

Sign In for Pricing
View Details
APOBEC3B Adenovirus (Human)
12167051 750 µL

APOBEC3B Adenovirus (Human)

Sign In for Pricing
View Details