Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L68 (MIMI_L68)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L68 (MIMI_L68) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Uncharacterized protein L68

UniProt

Q5UPE7

Expression Region

1-241

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYFSIIKITMITEIYFQYVIYILCFGVLLLLKSESDRLLWLHLVSILVGLIANYEMKFN VLFAMFHSAVHNLWPFLKNTGYDNTEKSVYDVICHTIMVVICYHQICYTENAVTNNYYTF HLFSVMIIIGALFNCVVSGKAIGSNDRFLHSLFEYTTIFQALSTGYWVATMLWYHHLDNI HFYSHWIIWIGLMTINWFVYKFYPNLVGISMRYKYVEAVFIVCTWYSGIISSPLIKYINV Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nafcillin-D5 Sodium Salt
RG-A261206-01 10 mg

Nafcillin-D5 Sodium Salt

Sign In for Pricing
View Details
Nafcillin-D5 Sodium Salt
RG-A261206-02 25 mg

Nafcillin-D5 Sodium Salt

Sign In for Pricing
View Details
Nafcillin-D5 Sodium Salt
RG-A261206-03 50 mg

Nafcillin-D5 Sodium Salt

Sign In for Pricing
View Details
Nafcillin-D5 Sodium Salt
RG-A261206-04 100 mg

Nafcillin-D5 Sodium Salt

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Cytidylate kinase (cmk)
MBS1460479-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Cytidylate kinase (cmk)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Cytidylate kinase (cmk)
MBS1460479-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Cytidylate kinase (cmk)

Sign In for Pricing
View Details