Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0073 membrane protein Mb1114c (Mb1114c)

This Recombinant UPF0073 membrane protein Mb1114c (Mb1114c) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

UPF0073 membrane protein Mb1114c

UniProt

P67158

Expression Region

1-242

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGQADTATTAEARTPAHAAHHLVEGVARVLTKPRFRGWIHVYSAGTAVLAGASLVAVSW AVGSAKAGLTTLAYTAATITMFTVSATYHRVNWKSATARNWMKRADHSMIFVFIAGSYTP FALLALPAHDGRVVLSIVWGGAIAGILLKMCWPAAPRSVGVPLYLLLGWVAVWYTATILH NAGVTALVLLFVGGALYSIGGILYAVRWPDPWPTTFGYHEFFHACTAVAAICHYIAMWFV VF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDG Recombinant Rabbit monoclonal Antibody
HA723180 100 µL

TDG Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Nexn activation kit by CRISPRa
GA207945 1 Kit

Mouse Nexn activation kit by CRISPRa

Sign In for Pricing
View Details
Human CRYBG3 activation kit by CRISPRa
GA115148 1 Kit

Human CRYBG3 activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H3 (mono methyl K79) Recombinant Rabbit monoclonal Antibody
HA751175 100 µL

Histone H3 (mono methyl K79) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Spermidine synthase (SRM) Human Gene Knockout Kit (CRISPR)
KN401761 1 Kit

Spermidine synthase (SRM) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
50 mM Thallium Sulfate Solution
7040S 5 mL

50 mM Thallium Sulfate Solution

Sign In for Pricing
View Details