Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R287 (MIMI_R287)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R287 (MIMI_R287) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Uncharacterized protein R287

UniProt

Q5UPW0

Expression Region

1-242

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCWNYQVSLIFSVIYVVTNSYYVVKRPLYWKQYLLFGSFYLTMEVFQTLQWLFGNVYSDS MYGQSVCNSINVNYTIVAFILIWLQPILFSVIGYQTTTTNKWFFRVLTVLNCFVFFYGLK LLYGGFEKPDYYTISDSMFGSSTCTNEGETGHLVWRFKPKTLDVFPNHLTYIILCIISFV MYENNATRVIGLGWLLSLIVTKLLLAPTLVEIASSWCLLSIIANLLIVAYVHISTGIYLT GQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR324 Human qPCR Template Standard (MI0000813)
HK300306 200 Reactions

MIR324 Human qPCR Template Standard (MI0000813)

Sign In for Pricing
View Details
HPGD antibody
70R-10224 50 ug

HPGD antibody

Sign In for Pricing
View Details
RNU6-28 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1851708 1.0 µg DNA

RNU6-28 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
OPN1SW Antibody (Biotin)
orb401547-01 50 µg

OPN1SW Antibody (Biotin)

Sign In for Pricing
View Details
OPN1SW Antibody (Biotin)
orb401547-02 100 µg

OPN1SW Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Salmonella hscB Protein (aa 1-171) (strain SL483)
VAng-Wyb1113-500gEcoli 500 µg (E. coli)

Recombinant Salmonella hscB Protein (aa 1-171) (strain SL483)

Sign In for Pricing
View Details