Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R287 (MIMI_R287)
This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R287 (MIMI_R287) spans the amino acid sequence from region 1-242.
Product Specifications
Product Name Alternative
Uncharacterized protein R287
UniProt
Q5UPW0
Expression Region
1-242
Origin
Acanthamoeba polyphaga mimivirus (APMV)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MCWNYQVSLIFSVIYVVTNSYYVVKRPLYWKQYLLFGSFYLTMEVFQTLQWLFGNVYSDS MYGQSVCNSINVNYTIVAFILIWLQPILFSVIGYQTTTTNKWFFRVLTVLNCFVFFYGLK LLYGGFEKPDYYTISDSMFGSSTCTNEGETGHLVWRFKPKTLDVFPNHLTYIILCIISFV MYENNATRVIGLGWLLSLIVTKLLLAPTLVEIASSWCLLSIIANLLIVAYVHISTGIYLT GQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP77933 1 Each
Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L) , partial
Sign In for Pricing
View Details 
MBS6405639-01 0.1 mL
ADIPOR1 (Adiponectin Receptor Protein 1, Progestin and AdipoQ Receptor Family Member I, CGI-45, PAQR1, ADIPOR1) (PE)
Sign In for Pricing
View Details MBS6405639-02 5x 0.1 mL
ADIPOR1 (Adiponectin Receptor Protein 1, Progestin and AdipoQ Receptor Family Member I, CGI-45, PAQR1, ADIPOR1) (PE)
Sign In for Pricing
View Details 
abx384942 96 Tests
Human G Protein Coupled Receptor 37 Like 1 (GPR37L1) ELISA Kit
Sign In for Pricing
View Details