Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia chaffeensis ATP synthase subunit a (atpB)

This Recombinant Ehrlichia chaffeensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2GFB2

Expression Region

1-243

Origin

Ehrlichia chaffeensis (strain Arkansas)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANPLDQFKISTIFKLPSIGGYNIDFTNASLFMVLSTLIISLFCYIGLRKENILPNSMQ LIIEAIYNFIVSTIESNVGRKGLQYIPLVFTIFTFIATCNLLGVLPLGFTVTSHIAVTFA ISMVVFISVTAIGFKHQGIHFLRILLPKGTPGWLAPMMVFIELFAYCARPVSLSIRLAAN MIAGHTIIKVIAGFVIKMNIFLTPLPMAFIIILIGFEIFVAILQAYIFTVLTCVYLSDAI NEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHC1, Phosphorylated (Y349) (SHC-transforming Protein 1, SHC-transforming Protein A, SHC, SHCA) (MaxLight 750)
MBS6437494-01 0.1 mL

SHC1, Phosphorylated (Y349) (SHC-transforming Protein 1, SHC-transforming Protein A, SHC, SHCA) (MaxLight 750)

Sign In for Pricing
View Details
SHC1, Phosphorylated (Y349) (SHC-transforming Protein 1, SHC-transforming Protein A, SHC, SHCA) (MaxLight 750)
MBS6437494-02 5x 0.1 mL

SHC1, Phosphorylated (Y349) (SHC-transforming Protein 1, SHC-transforming Protein A, SHC, SHCA) (MaxLight 750)

Sign In for Pricing
View Details
Tube Rack
R1040-R 5 Units/Pack

Tube Rack

Sign In for Pricing
View Details
Rat Cell surface glycoprotein CD200 receptor 1 (CD200R1) ELISA Kit
MBS7222542-01 48 Well

Rat Cell surface glycoprotein CD200 receptor 1 (CD200R1) ELISA Kit

Sign In for Pricing
View Details
Rat Cell surface glycoprotein CD200 receptor 1 (CD200R1) ELISA Kit
MBS7222542-02 96 Well

Rat Cell surface glycoprotein CD200 receptor 1 (CD200R1) ELISA Kit

Sign In for Pricing
View Details
Rat Cell surface glycoprotein CD200 receptor 1 (CD200R1) ELISA Kit
MBS7222542-03 5x 96 Well

Rat Cell surface glycoprotein CD200 receptor 1 (CD200R1) ELISA Kit

Sign In for Pricing
View Details