Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia chaffeensis ATP synthase subunit a (atpB)

This Recombinant Ehrlichia chaffeensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2GFB2

Expression Region

1-243

Origin

Ehrlichia chaffeensis (strain Arkansas)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANPLDQFKISTIFKLPSIGGYNIDFTNASLFMVLSTLIISLFCYIGLRKENILPNSMQ LIIEAIYNFIVSTIESNVGRKGLQYIPLVFTIFTFIATCNLLGVLPLGFTVTSHIAVTFA ISMVVFISVTAIGFKHQGIHFLRILLPKGTPGWLAPMMVFIELFAYCARPVSLSIRLAAN MIAGHTIIKVIAGFVIKMNIFLTPLPMAFIIILIGFEIFVAILQAYIFTVLTCVYLSDAI NEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 5- (4-methoxy-3-methylphenyl) -3-methyl-1H-pyrrole-2-carboxylate
OR1051347-01 100 mg

Ethyl 5- (4-methoxy-3-methylphenyl) -3-methyl-1H-pyrrole-2-carboxylate

Sign In for Pricing
View Details
Ethyl 5- (4-methoxy-3-methylphenyl) -3-methyl-1H-pyrrole-2-carboxylate
OR1051347-02 250 mg

Ethyl 5- (4-methoxy-3-methylphenyl) -3-methyl-1H-pyrrole-2-carboxylate

Sign In for Pricing
View Details
Human Alpha-glutathione S-transferases, alpha-GST ELISA KIT
E1505Hu-01 48 Well

Human Alpha-glutathione S-transferases, alpha-GST ELISA KIT

Sign In for Pricing
View Details
Human Alpha-glutathione S-transferases, alpha-GST ELISA KIT
E1505Hu-02 96 Well

Human Alpha-glutathione S-transferases, alpha-GST ELISA KIT

Sign In for Pricing
View Details
Human Alpha-glutathione S-transferases, alpha-GST ELISA KIT
E1505Hu-03 5x 96 Tests

Human Alpha-glutathione S-transferases, alpha-GST ELISA KIT

Sign In for Pricing
View Details
Human Alpha-glutathione S-transferases, alpha-GST ELISA KIT
E1505Hu-04 10x 96 Tests

Human Alpha-glutathione S-transferases, alpha-GST ELISA KIT

Sign In for Pricing
View Details