Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia canis ATP synthase subunit a (atpB)

This Recombinant Ehrlichia canis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3YQV2

Expression Region

1-243

Origin

Ehrlichia canis (strain Jake)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASPLDQFKILTIFKLPNIAGYNIDFTNASLFMVLSTISVALFCYIGLKKESIIPNGIQ SIVEFIYEFIVSTIESNVGKEGLQYIPLVFTIFMFIATCNLLGILPLGFTATSHIAVTFA ISMVVFVSVTIIGFKHQGIHFLRILLPQGTPGWLAPMMVFIELFAYCARPVSLSIRLAAN MIAGHTIIKVIAGFVVKMNIFLTPLPMIFIIILIGFEIFVAILQAYIFTVLTCVYLSDAV KEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HS6ST2 Antibody
KC-43845-01 50 μL

HS6ST2 Antibody

Sign In for Pricing
View Details
HS6ST2 Antibody
KC-43845-02 100 µL

HS6ST2 Antibody

Sign In for Pricing
View Details
HS6ST2 Antibody
KC-43845-03 1 mL

HS6ST2 Antibody

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis), CF740 conjugate, 0.1mg/mL
BNC741751-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Sulfite
TRC-S689135-250G 250 g

Sodium Sulfite

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (MUC18/1130), CF647 conjugate, 0.1mg/mL
BNC471130-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (MUC18/1130), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details