Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia canis ATP synthase subunit a (atpB)

This Recombinant Ehrlichia canis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3YQV2

Expression Region

1-243

Origin

Ehrlichia canis (strain Jake)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASPLDQFKILTIFKLPNIAGYNIDFTNASLFMVLSTISVALFCYIGLKKESIIPNGIQ SIVEFIYEFIVSTIESNVGKEGLQYIPLVFTIFMFIATCNLLGILPLGFTATSHIAVTFA ISMVVFVSVTIIGFKHQGIHFLRILLPQGTPGWLAPMMVFIELFAYCARPVSLSIRLAAN MIAGHTIIKVIAGFVVKMNIFLTPLPMIFIIILIGFEIFVAILQAYIFTVLTCVYLSDAV KEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195L-01 20 Tests

Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195L-02 100 Tests

Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Rabbit IgG (H&L) Antibody Rhodamine Conjugated Pre-Adsorbed
TA397965 1 mg

Rabbit IgG (H&L) Antibody Rhodamine Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
IKB epsilon (NFKBIE) Mouse Monoclonal Antibody [Clone ID: OTI6D8]
CF810720 100 µg

IKB epsilon (NFKBIE) Mouse Monoclonal Antibody [Clone ID: OTI6D8]

Sign In for Pricing
View Details
UBE2Q2L Human Gene Knockout Kit (CRISPR)
KN431755 1 Kit

UBE2Q2L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details