Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans ATP synthase subunit a (ATP6)

This Recombinant Candida albicans ATP synthase subunit a (ATP6) spans the amino acid sequence from region 4-246.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase subunit 6, F-ATPase protein 6

UniProt

Q9B8D4

Expression Region

4-246

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPLDQFEIKPLLMVNNILTLALTNYTLYLIIVVSIIFGYTSIISNGRLGSTRWGVAIIAI YDTILNLVYSQIGKAGGHFFPLIFTIFNLIFAANLISMIPYSFAISAQLVAIVSFSLALW IGNVILGLYLHGWGFFALFVPSGTPLPLVPILVLIEALSYSSRAISLGLRLGANILSGHL LMLILGSLIVNLMSSSILGFIGGIVPIVAVIAITILEVGIAIIQAYVFSILLSGYIKDSV SLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 Mouse Monoclonal Antibody [Clone ID: GHI/61]
AM26138RP-N 100 Tests

CD163 Mouse Monoclonal Antibody [Clone ID: GHI/61]

Sign In for Pricing
View Details
Anti-ALDH3A2
Y058824 100 µg

Anti-ALDH3A2

Sign In for Pricing
View Details
Recombinant ME2 Antibody
RC-5795-01 50 μL

Recombinant ME2 Antibody

Sign In for Pricing
View Details
Recombinant ME2 Antibody
RC-5795-02 100 µL

Recombinant ME2 Antibody

Sign In for Pricing
View Details
Recombinant ME2 Antibody
RC-5795-03 1 mL

Recombinant ME2 Antibody

Sign In for Pricing
View Details
Recombinant Mouse Uteroglobin/SCGB1A1 Protein (His Tag)
PKSM040754 100 µg

Recombinant Mouse Uteroglobin/SCGB1A1 Protein (His Tag)

Sign In for Pricing
View Details