Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans ATP synthase subunit a (ATP6)

This Recombinant Candida albicans ATP synthase subunit a (ATP6) spans the amino acid sequence from region 4-246.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase subunit 6, F-ATPase protein 6

UniProt

Q9B8D4

Expression Region

4-246

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPLDQFEIKPLLMVNNILTLALTNYTLYLIIVVSIIFGYTSIISNGRLGSTRWGVAIIAI YDTILNLVYSQIGKAGGHFFPLIFTIFNLIFAANLISMIPYSFAISAQLVAIVSFSLALW IGNVILGLYLHGWGFFALFVPSGTPLPLVPILVLIEALSYSSRAISLGLRLGANILSGHL LMLILGSLIVNLMSSSILGFIGGIVPIVAVIAITILEVGIAIIQAYVFSILLSGYIKDSV SLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Aβ1-42 (Amyloid Beta 1-42) ELISA Kit
E-EL-R1402-01 24 Tests

Rat Aβ1-42 (Amyloid Beta 1-42) ELISA Kit

Sign In for Pricing
View Details
Rat Aβ1-42 (Amyloid Beta 1-42) ELISA Kit
E-EL-R1402-02 48 Tests

Rat Aβ1-42 (Amyloid Beta 1-42) ELISA Kit

Sign In for Pricing
View Details
Rat Aβ1-42 (Amyloid Beta 1-42) ELISA Kit
E-EL-R1402-03 96 Tests

Rat Aβ1-42 (Amyloid Beta 1-42) ELISA Kit

Sign In for Pricing
View Details
Human IFT80 activation kit by CRISPRa
GA111589 1 Kit

Human IFT80 activation kit by CRISPRa

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF568 conjugate, 0.1mg/mL
BNC681384-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CacyBP Rabbit Polyclonal Antibody
HA500484 100 µL

CacyBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details