Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pumilus ATP synthase subunit a (atpB)

This Recombinant Bacillus pumilus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A8FIB8

Expression Region

1-244

Origin

Bacillus pumilus (strain SAFR-032)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHSSKTTEFLGLTFNLSNVLMITIASIIVLLIAVLTTRVLSIRPTKAQNFMEWIVDFVR NIIGSSMDMKTGAPFLALGVTLLMYIFVSNMLGLPFSISVDHNLWWKSPTADPAITMTLA VMVMGLTHYYGVKAKGVKEYTKDYFRPIPLLVPLKIIEEFANTLTLGLRLYGNIFAGEIL LGLLAGLATNFYSQNIALGIIGTLGAIVPMIVWQAFSLFVGTIQAFIFTMLTMVYISHKV SDEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-S-(3,4-dihydroxybutyl)-L-cysteine-13C4 (Mixture of Diastereomers)
TRC-A173713-5MG 5 mg

N-Acetyl-S-(3,4-dihydroxybutyl)-L-cysteine-13C4 (Mixture of Diastereomers)

Sign In for Pricing
View Details
TAX1BP1 Human Knockdown Lysate
LY300308 100 µg

TAX1BP1 Human Knockdown Lysate

Sign In for Pricing
View Details
TM9SF1 Rabbit Polyclonal Antibody
TA382580 100 µL

TM9SF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Buthiobate
TRC-B999580-50MG 50 mg

Buthiobate

Sign In for Pricing
View Details
DREF (ZBED1) (NM_001171135) Human Recombinant Protein
TP720555M 50 µg

DREF (ZBED1) (NM_001171135) Human Recombinant Protein

Sign In for Pricing
View Details
Caspase 4 (CASP4) (1-270) Mouse Monoclonal Antibody [Clone ID: 4B9]
AM26585AF-N 100 µg

Caspase 4 (CASP4) (1-270) Mouse Monoclonal Antibody [Clone ID: 4B9]

Sign In for Pricing
View Details