Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pumilus ATP synthase subunit a (atpB)

This Recombinant Bacillus pumilus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A8FIB8

Expression Region

1-244

Origin

Bacillus pumilus (strain SAFR-032)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHSSKTTEFLGLTFNLSNVLMITIASIIVLLIAVLTTRVLSIRPTKAQNFMEWIVDFVR NIIGSSMDMKTGAPFLALGVTLLMYIFVSNMLGLPFSISVDHNLWWKSPTADPAITMTLA VMVMGLTHYYGVKAKGVKEYTKDYFRPIPLLVPLKIIEEFANTLTLGLRLYGNIFAGEIL LGLLAGLATNFYSQNIALGIIGTLGAIVPMIVWQAFSLFVGTIQAFIFTMLTMVYISHKV SDEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB1 Human Gene Knockout Kit (CRISPR)
KN208384 1 Kit

NFKB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isopropyl Benzenesulfonate
TRC-I824350-10MG 10 mg

Isopropyl Benzenesulfonate

Sign In for Pricing
View Details
ABI2 Antibody
KC-48309-01 50 μL

ABI2 Antibody

Sign In for Pricing
View Details
ABI2 Antibody
KC-48309-02 100 µL

ABI2 Antibody

Sign In for Pricing
View Details
ABI2 Antibody
KC-48309-03 1 mL

ABI2 Antibody

Sign In for Pricing
View Details
Ubiquilin (UBQLN1) (NM_013438) Human Over-expression Lysate
LY402265 100 µg

Ubiquilin (UBQLN1) (NM_013438) Human Over-expression Lysate

Sign In for Pricing
View Details