Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pumilus ATP synthase subunit a (atpB)

This Recombinant Bacillus pumilus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A8FIB8

Expression Region

1-244

Origin

Bacillus pumilus (strain SAFR-032)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHSSKTTEFLGLTFNLSNVLMITIASIIVLLIAVLTTRVLSIRPTKAQNFMEWIVDFVR NIIGSSMDMKTGAPFLALGVTLLMYIFVSNMLGLPFSISVDHNLWWKSPTADPAITMTLA VMVMGLTHYYGVKAKGVKEYTKDYFRPIPLLVPLKIIEEFANTLTLGLRLYGNIFAGEIL LGLLAGLATNFYSQNIALGIIGTLGAIVPMIVWQAFSLFVGTIQAFIFTMLTMVYISHKV SDEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal Guard™ phosphatase reaction stopping solution
11622-AAT 100 mL

Signal Guard™ phosphatase reaction stopping solution

Sign In for Pricing
View Details
ELAVL2 Antibody
OC-355-01 50 μL

ELAVL2 Antibody

Sign In for Pricing
View Details
ELAVL2 Antibody
OC-355-02 100 µL

ELAVL2 Antibody

Sign In for Pricing
View Details
ELAVL2 Antibody
OC-355-03 1 mL

ELAVL2 Antibody

Sign In for Pricing
View Details
WSCD2 Mouse Monoclonal Antibody [9-F3]
M1010-2 100 µL

WSCD2 Mouse Monoclonal Antibody [9-F3]

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein A-I/ApoAI Protein (His Tag, E. coli)
PKSH032081-01 10 µg

Recombinant Human Apolipoprotein A-I/ApoAI Protein (His Tag, E. coli)

Sign In for Pricing
View Details