Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brevibacillus brevis Cobalamin synthase (cobS)

This Recombinant Brevibacillus brevis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C0Z7H6

Expression Region

1-246

Origin

Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAFLHAISFFTRIPVPWLRPSEEAWRKSVNWYPAVGLVIGLLLWGVHQAGLVLFSPWIA AILTLIAWVYVTGGLHMDGWMDLADGLGSSRPREQILAIMKDSRVGAMGVLAAIMLLLIK AGAVAELAHPGWGSFLIVAPVAARTHVLLSIKLWPYLSADKGIGKGISSGLSVSSIIVSY IIVFAAGWYLGGLQVMTAIFLSLLFALWFSRSVAKKLGGLNGDCYGAVIESSEAVVLLVL VGSWWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cyclooxygenase-receptor2, COX-2R ELISA Kit
YLA0604HU-01 48 Tests

Human cyclooxygenase-receptor2, COX-2R ELISA Kit

Sign In for Pricing
View Details
Human cyclooxygenase-receptor2, COX-2R ELISA Kit
YLA0604HU-02 96 Tests

Human cyclooxygenase-receptor2, COX-2R ELISA Kit

Sign In for Pricing
View Details
hsa-miR-659-3p miRNA Inhibitor
MBS8293242-01 10 nmol

hsa-miR-659-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-659-3p miRNA Inhibitor
MBS8293242-02 20 nmol

hsa-miR-659-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-659-3p miRNA Inhibitor
MBS8293242-03 5x 20 nmol

hsa-miR-659-3p miRNA Inhibitor

Sign In for Pricing
View Details
Phospho-Serine Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-11993R-BF488 100 µL

Phospho-Serine Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details