Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brevibacillus brevis Cobalamin synthase (cobS)

This Recombinant Brevibacillus brevis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C0Z7H6

Expression Region

1-246

Origin

Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAFLHAISFFTRIPVPWLRPSEEAWRKSVNWYPAVGLVIGLLLWGVHQAGLVLFSPWIA AILTLIAWVYVTGGLHMDGWMDLADGLGSSRPREQILAIMKDSRVGAMGVLAAIMLLLIK AGAVAELAHPGWGSFLIVAPVAARTHVLLSIKLWPYLSADKGIGKGISSGLSVSSIIVSY IIVFAAGWYLGGLQVMTAIFLSLLFALWFSRSVAKKLGGLNGDCYGAVIESSEAVVLLVL VGSWWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPLD1 Protein Vector (Human) (pPB-C-His)
PV018329 500 ng

GPLD1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
HPS1 Protein Vector (Rat) (pPB-C-His)
PV273374 500 ng

HPS1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
NKAIN1 Antibody - C-terminal region
OAAB08748-400UL 400 µL

NKAIN1 Antibody - C-terminal region

Sign In for Pricing
View Details
AMS Antibody
orb784447 2 mg

AMS Antibody

Sign In for Pricing
View Details
Frabin CRISPR/Cas9 KO Plasmid (h)
sc-410269 20 µg

Frabin CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Ing4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3724407 1.0 µg DNA

Ing4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details