Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brevibacillus brevis Cobalamin synthase (cobS)

This Recombinant Brevibacillus brevis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C0Z7H6

Expression Region

1-246

Origin

Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAFLHAISFFTRIPVPWLRPSEEAWRKSVNWYPAVGLVIGLLLWGVHQAGLVLFSPWIA AILTLIAWVYVTGGLHMDGWMDLADGLGSSRPREQILAIMKDSRVGAMGVLAAIMLLLIK AGAVAELAHPGWGSFLIVAPVAARTHVLLSIKLWPYLSADKGIGKGISSGLSVSSIIVSY IIVFAAGWYLGGLQVMTAIFLSLLFALWFSRSVAKKLGGLNGDCYGAVIESSEAVVLLVL VGSWWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cdh5 shRNA (UAS) - Lentiviral mouse Cdh5 shRNA (UAS, RFP) plasmid
GTR15213109 1 Vial

Lentiviral mouse Cdh5 shRNA (UAS) - Lentiviral mouse Cdh5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Neil3-set siRNA/shRNA/RNAi Lentivector (Rat)
31698096 4x 500 ng

Neil3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Anti-KIF3A Monoclonal Antibody
M03439 100 µL/Vial

Anti-KIF3A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:3 Phosphoenolpyruvate carboxykinase [ATP] (pckA), partial
MBS1155301 Inquire

Recombinant Yersinia pseudotuberculosis serotype O:3 Phosphoenolpyruvate carboxykinase [ATP] (pckA), partial

Sign In for Pricing
View Details
Lentiviral human UNC93B1 shRNA (UAS) - Lentiviral human UNC93B1 shRNA (UAS, RFP) (25)
GTR15104183 1 Vial

Lentiviral human UNC93B1 shRNA (UAS) - Lentiviral human UNC93B1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral mouse Arhgef9 shRNA (UAS) - Lentiviral mouse Arhgef9 shRNA (UAS, GFP) plasmid
GTR15197998 1 Vial

Lentiviral mouse Arhgef9 shRNA (UAS) - Lentiviral mouse Arhgef9 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details