Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Mannose-P-dolichol utilization defect 1 protein (MPDU1)

This Recombinant Cricetulus griseus Mannose-P-dolichol utilization defect 1 protein (MPDU1) spans the amino acid sequence from region 2-247.

Product Specifications

Product Name Alternative

Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation, SL15

UniProt

Q60441

Expression Region

2-247

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGEADGPFKRVLVPVLLPEKCYDQLFVHWDFLHVPCLKILLSKGLGLGIVAGSLLVKLPQ IFKILGAKSAEGLSLQSVMLELVALTGTVIYSITNNFPFSSWGEALFLTLQTITICLLVL HYRGDTVKGVALLACYATLLLALLSPLTPLAVVTMLQASNVPAVVVGKLLQAATNYHNGH TGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKPPH KHKKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bosakitug Biosimilar (Monoclonal, IgG1)
A137964 100 µL

Bosakitug Biosimilar (Monoclonal, IgG1)

Sign In for Pricing
View Details
Rabbit anti PLAC1 (Hu) Polyclonal Antibody
MBS460501-01 0.1 mg

Rabbit anti PLAC1 (Hu) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti PLAC1 (Hu) Polyclonal Antibody
MBS460501-02 5x 0.1 mg

Rabbit anti PLAC1 (Hu) Polyclonal Antibody

Sign In for Pricing
View Details
TPM1 Protein Vector (Human) (pPM-C-HA)
PV043543 500 ng

TPM1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Phospho-Caseine Kinase 1 alpha (Tyr294) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12428R-BF350-01 20 µL

Phospho-Caseine Kinase 1 alpha (Tyr294) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Phospho-Caseine Kinase 1 alpha (Tyr294) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12428R-BF350-02 100 µL

Phospho-Caseine Kinase 1 alpha (Tyr294) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details