Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Mannose-P-dolichol utilization defect 1 protein (MPDU1)

This Recombinant Cricetulus griseus Mannose-P-dolichol utilization defect 1 protein (MPDU1) spans the amino acid sequence from region 2-247.

Product Specifications

Product Name Alternative

Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation, SL15

UniProt

Q60441

Expression Region

2-247

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGEADGPFKRVLVPVLLPEKCYDQLFVHWDFLHVPCLKILLSKGLGLGIVAGSLLVKLPQ IFKILGAKSAEGLSLQSVMLELVALTGTVIYSITNNFPFSSWGEALFLTLQTITICLLVL HYRGDTVKGVALLACYATLLLALLSPLTPLAVVTMLQASNVPAVVVGKLLQAATNYHNGH TGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKPPH KHKKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VDAC1 Antibody
E19-6140 100 µg -100 µL

VDAC1 Antibody

Sign In for Pricing
View Details
Fmoc-O-2,6-dichlorobenzyl-D-tyrosine
sc-472863 250 mg

Fmoc-O-2,6-dichlorobenzyl-D-tyrosine

Sign In for Pricing
View Details
Rd3l (NM_001134560) Rat Tagged Lenti ORF Clone
RR215373L3 10 µg

Rd3l (NM_001134560) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Human Synuclein-alpha antiserum # 1
SYN11-S 100 µL

Anti-Human Synuclein-alpha antiserum # 1

Sign In for Pricing
View Details
NHE-8 Polyclonal Antibody
MBS2536986-01 0.02 mL

NHE-8 Polyclonal Antibody

Sign In for Pricing
View Details
NHE-8 Polyclonal Antibody
MBS2536986-02 0.06 mL

NHE-8 Polyclonal Antibody

Sign In for Pricing
View Details