Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Mannose-P-dolichol utilization defect 1 protein (MPDU1)

This Recombinant Cricetulus griseus Mannose-P-dolichol utilization defect 1 protein (MPDU1) spans the amino acid sequence from region 2-247.

Product Specifications

Product Name Alternative

Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation, SL15

UniProt

Q60441

Expression Region

2-247

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGEADGPFKRVLVPVLLPEKCYDQLFVHWDFLHVPCLKILLSKGLGLGIVAGSLLVKLPQ IFKILGAKSAEGLSLQSVMLELVALTGTVIYSITNNFPFSSWGEALFLTLQTITICLLVL HYRGDTVKGVALLACYATLLLALLSPLTPLAVVTMLQASNVPAVVVGKLLQAATNYHNGH TGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKPPH KHKKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triethanolamine for Synthesis 98.0%
247145-01 25 L

Triethanolamine for Synthesis 98.0%

Sign In for Pricing
View Details
Triethanolamine for Synthesis 98.0%
247145-02 50 L

Triethanolamine for Synthesis 98.0%

Sign In for Pricing
View Details
Triethanolamine for Synthesis 98.0%
247145-03 500 mL

Triethanolamine for Synthesis 98.0%

Sign In for Pricing
View Details
Triethanolamine for Synthesis 98.0%
247145-04 2.5 L

Triethanolamine for Synthesis 98.0%

Sign In for Pricing
View Details
Stat4 (E687) polyclonal antibody
BS1427 50ul

Stat4 (E687) polyclonal antibody

Sign In for Pricing
View Details
CCDC84 Antibody, HRP conjugated
A59596-50UG 50 µg

CCDC84 Antibody, HRP conjugated

Sign In for Pricing
View Details