Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mannose-P-dolichol utilization defect 1 protein (Mpdu1)

This Recombinant Mouse Mannose-P-dolichol utilization defect 1 protein (Mpdu1) spans the amino acid sequence from region 2-247.

Product Specifications

Product Name Alternative

Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation homolog, SL15

UniProt

Q9R0Q9

Expression Region

2-247

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGEADGRFKGLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQ VFKLLGAKSAEGLSLQSVMLELVALTGTVVYSITNNFPFSSWGEALFLTLQTVAICFLVM HYRGETVKGVAFLACYAMVLLALLSPLTPLAVVTLLQASNVPAVVVGKLLQAATNYRNGH TGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKAPH KQKKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A1-3 Galactobiosyl b-methyl glycoside
297135-01 2 mg

A1-3 Galactobiosyl b-methyl glycoside

Sign In for Pricing
View Details
A1-3 Galactobiosyl b-methyl glycoside
297135-02 5 mg

A1-3 Galactobiosyl b-methyl glycoside

Sign In for Pricing
View Details
A1-3 Galactobiosyl b-methyl glycoside
297135-03 10 mg

A1-3 Galactobiosyl b-methyl glycoside

Sign In for Pricing
View Details
A1-3 Galactobiosyl b-methyl glycoside
297135-04 25 mg

A1-3 Galactobiosyl b-methyl glycoside

Sign In for Pricing
View Details
Pbld sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6947307 1.0 µg DNA

Pbld sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Relaxin (RLN)
MBS2052652 Inquire

Cy3-Linked Monoclonal Antibody to Relaxin (RLN)

Sign In for Pricing
View Details