Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mannose-P-dolichol utilization defect 1 protein (Mpdu1)

This Recombinant Mouse Mannose-P-dolichol utilization defect 1 protein (Mpdu1) spans the amino acid sequence from region 2-247.

Product Specifications

Product Name Alternative

Mannose-P-dolichol utilization defect 1 protein, Suppressor of Lec15 and Lec35 glycosylation mutation homolog, SL15

UniProt

Q9R0Q9

Expression Region

2-247

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGEADGRFKGLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQ VFKLLGAKSAEGLSLQSVMLELVALTGTVVYSITNNFPFSSWGEALFLTLQTVAICFLVM HYRGETVKGVAFLACYAMVLLALLSPLTPLAVVTLLQASNVPAVVVGKLLQAATNYRNGH TGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSSLCNGLIAAQVLFYWNAKAPH KQKKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ron (Phospho-Tyr1238+Tyr1239) Antibody FITC Conjugated
orb1543426 100 µL

Ron (Phospho-Tyr1238+Tyr1239) Antibody FITC Conjugated

Sign In for Pricing
View Details
Anti-PDE2A Antibody (Biotin)
STJ502260 100 µg

Anti-PDE2A Antibody (Biotin)

Sign In for Pricing
View Details
Reelin Rabbit Polyclonal Antibody
orb221867-01 50 μL

Reelin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Reelin Rabbit Polyclonal Antibody
orb221867-02 100 µL

Reelin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Reelin Rabbit Polyclonal Antibody
orb221867-03 200 µL

Reelin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Shigella sonnei Acetyltransferase YpeA (ypeA)
MBS1484483-01 0.02 mg (E-Coli)

Recombinant Shigella sonnei Acetyltransferase YpeA (ypeA)

Sign In for Pricing
View Details