Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Monocyte to macrophage differentiation factor 2 (Mmd2)

This Recombinant Mouse Monocyte to macrophage differentiation factor 2 (Mmd2) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Monocyte to macrophage differentiation factor 2, Progestin and adipoQ receptor family member X

UniProt

Q8R189

Expression Region

1-247

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTLARLLDFQKTKYARFMNDRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFL SDDDWETISAWIYGLGLCGLFVVSTIFHTVSWKKSHLRMVEHCLHMIDRMVIYFFIAASY APWLNLRELGPWASHMRWLVWIMASIGTIYVFFFHERYKLVELLCYVVMGFFPALVILSM PNTDGIWELMTGGAFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPST LQTKVSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Native Human Complement C1s Enzyme Protein
CTP-493 250 µg

Native Human Complement C1s Enzyme Protein

Sign In for Pricing
View Details
Lentiviral mouse Hscb shRNA (UAS) - Lentiviral mouse Hscb shRNA (UAS) (100)
GTR15156366 1 Vial

Lentiviral mouse Hscb shRNA (UAS) - Lentiviral mouse Hscb shRNA (UAS) (100)

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561781 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
TORC2 Monoclonal Antibody
UB-GEN-1002 100 µL

TORC2 Monoclonal Antibody

Sign In for Pricing
View Details
CCD34 Antibody
C42932-01 50 µL

CCD34 Antibody

Sign In for Pricing
View Details
CCD34 Antibody
C42932-02 100 µL

CCD34 Antibody

Sign In for Pricing
View Details