Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Monocyte to macrophage differentiation factor 2 (Mmd2)

This Recombinant Mouse Monocyte to macrophage differentiation factor 2 (Mmd2) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Monocyte to macrophage differentiation factor 2, Progestin and adipoQ receptor family member X

UniProt

Q8R189

Expression Region

1-247

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTLARLLDFQKTKYARFMNDRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFL SDDDWETISAWIYGLGLCGLFVVSTIFHTVSWKKSHLRMVEHCLHMIDRMVIYFFIAASY APWLNLRELGPWASHMRWLVWIMASIGTIYVFFFHERYKLVELLCYVVMGFFPALVILSM PNTDGIWELMTGGAFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPST LQTKVSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DARC Recombinant Antibody, APC Conjugated
bsm-61907R-APC-TR 20 µL

DARC Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Human/Mouse/Rat Cytochrome c MAb (Clone 2.7D5)
MAB899-SP 25 µg

Human/Mouse/Rat Cytochrome c MAb (Clone 2.7D5)

Sign In for Pricing
View Details
CRIP1 Rabbit pAb, IRDye 800CW conjugated
orb2881824 100 µL

CRIP1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Nuclear factor erythroid 2-related factor 1
orb1638536-01 50 µg

Nuclear factor erythroid 2-related factor 1

Sign In for Pricing
View Details
Nuclear factor erythroid 2-related factor 1
orb1638536-02 100 µg

Nuclear factor erythroid 2-related factor 1

Sign In for Pricing
View Details
Nuclear factor erythroid 2-related factor 1
orb1638536-03 1 mg

Nuclear factor erythroid 2-related factor 1

Sign In for Pricing
View Details