Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prosthecochloris aestuarii Cobalamin synthase (cobS)

This Recombinant Prosthecochloris aestuarii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B4S891

Expression Region

1-248

Origin

Prosthecochloris aestuarii (strain DSM 271 / SK 413)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDGLVTAMRTLTVLSVPGKDADEFSRSLYWFPLVGLLLGLLQAALAWIGMVSQIPEFSA LLVLLSGVLLTRAIHADGLADLADGFFGGKTRESRLRIMKDPAVGSFGVIALILLFLFKW IALTRIVAHGQYEWIVSGIVLARFVQVVLASVMTYAREGEGTACRFVAGAGGWHVVVAAL FSLLILVLVMKMQRLPIVVALLATAVSGSLTGMLAAKKIHGVTGDVLGASSEMTEALVWC SALLLLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTND6P18 Protein Vector (Human) (pPM-C-His)
PV102729 500 ng

MTND6P18 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
mmu-miR-6926-5p miRNA Inhibitor
MIM02598 2x 5.0 nmol

mmu-miR-6926-5p miRNA Inhibitor

Sign In for Pricing
View Details
Tissue, Total Protein, Human Adult Normal, Small intestine, Ileum
MBS657599-01 1 mg

Tissue, Total Protein, Human Adult Normal, Small intestine, Ileum

Sign In for Pricing
View Details
Tissue, Total Protein, Human Adult Normal, Small intestine, Ileum
MBS657599-02 5x 1 mg

Tissue, Total Protein, Human Adult Normal, Small intestine, Ileum

Sign In for Pricing
View Details
ARHGEF6 Knockout A549 Polyclonal Cells
ARG31631 1 Million

ARHGEF6 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Phospho-Integrin beta 1 (Tyr783) Rabbit pAb, IRDye 800CW conjugated
orb2857109 100 µL

Phospho-Integrin beta 1 (Tyr783) Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details