Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis ATP synthase subunit a (ATP6)

This Recombinant Ustilago maydis ATP synthase subunit a (ATP6) spans the amino acid sequence from region 7-254.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q0H8Y6

Expression Region

7-254

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPLEQFEVTSLISLNLPVLGYINLSLTNLGLYTILTVYLVLALHIMGSNNKQLIPSRWSI ALESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPYGFTVATSIMVSIGL SMTIFIGVTILGLRLHKVHFFSFFVPSGTPLGLVPLLVPIELISYLARAFSLGVRLFANV TAGHVLMKILAGFLAPLFTSTFIISVLTVLPFIIFTGIIGLEIAVSFIQAYVFCVLTCSY LKDAIDLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il17rc Mouse Gene Knockout Kit (CRISPR)
KN308241BN 1 Kit

Il17rc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4,4'-O-(2-Amino-1,3-propanediyl)bis-D-mannose Hydrochloride
TRC-A628070-5MG 5 mg

4,4'-O-(2-Amino-1,3-propanediyl)bis-D-mannose Hydrochloride

Sign In for Pricing
View Details
Recombinant Human HVEM/TNFRSF14 Protein (Fc Tag)
PKSH033487-01 10 µg

Recombinant Human HVEM/TNFRSF14 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human HVEM/TNFRSF14 Protein (Fc Tag)
PKSH033487-02 50 µg

Recombinant Human HVEM/TNFRSF14 Protein (Fc Tag)

Sign In for Pricing
View Details
CD66 (CEA) (COL-1), CF647 conjugate, 0.1mg/mL
BNC470002-500 1x 500 µL

CD66 (CEA) (COL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF740 conjugate, 0.1mg/mL
BNC742925-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details