Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis ATP synthase subunit a (ATP6)

This Recombinant Ustilago maydis ATP synthase subunit a (ATP6) spans the amino acid sequence from region 7-254.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q0H8Y6

Expression Region

7-254

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPLEQFEVTSLISLNLPVLGYINLSLTNLGLYTILTVYLVLALHIMGSNNKQLIPSRWSI ALESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPYGFTVATSIMVSIGL SMTIFIGVTILGLRLHKVHFFSFFVPSGTPLGLVPLLVPIELISYLARAFSLGVRLFANV TAGHVLMKILAGFLAPLFTSTFIISVLTVLPFIIFTGIIGLEIAVSFIQAYVFCVLTCSY LKDAIDLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pnrc2 (NM_026383) Mouse Tagged ORF Clone
MG200889 10 µg

Pnrc2 (NM_026383) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 12 (MMP12) ELISA Kit
RDR-MMP12-Mu-01 96 Tests

Mouse Matrix Metalloproteinase 12 (MMP12) ELISA Kit

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 12 (MMP12) ELISA Kit
RDR-MMP12-Mu-02 48 Tests

Mouse Matrix Metalloproteinase 12 (MMP12) ELISA Kit

Sign In for Pricing
View Details
N-(2-Cyanoethyl)-N-ethylamine
TRC-C980045-5G 5 g

N-(2-Cyanoethyl)-N-ethylamine

Sign In for Pricing
View Details
Ankib1 Mouse Gene Knockout Kit (CRISPR)
KN501255 1 Kit

Ankib1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTTY8 (NR_001533) Human Over-expression Lysate
LC403760 20 µg

TTTY8 (NR_001533) Human Over-expression Lysate

Sign In for Pricing
View Details