Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (ATP6)

This Recombinant ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q37601

Expression Region

1-248

Origin

Pylaiella littoralis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNSPLEQFEILPLLSFGANLFDFSITNAMLTTCVSLSFFLFLFYCLFSYGLNSFPTRWQ LVLEGLYTSTAGLVWDSVGPRRPKVFPFLFVIFSFILISNVQGLVPYSFTITSHLIQTMV LALTVFIGVIIIVLAHGFHMLSLFLPGGTSIVLAFLLVPIEIVSYVFKPLSLAVRLFANM MAGHTLLKVIAAVAWAMMGSGGLLLIAHIVPLGVLVILFGLELAVALIQAYVFTILSCIY INDAIVLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP4 Antibody
orb1314976-01 30 µL

ELP4 Antibody

Sign In for Pricing
View Details
ELP4 Antibody
orb1314976-02 50 μL

ELP4 Antibody

Sign In for Pricing
View Details
ELP4 Antibody
orb1314976-03 100 µL

ELP4 Antibody

Sign In for Pricing
View Details
cis-(+)-Decen-1-yl Disparlure
TRC-D415650-25MG 25 mg

cis-(+)-Decen-1-yl Disparlure

Sign In for Pricing
View Details
RBM22 Protein Vector (Human) (pPB-C-His)
PV034569 500 ng

RBM22 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
H3N1 hemagglutinin Rabbit Polyclonal Antibody
orb157414-01 50 μL

H3N1 hemagglutinin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details