Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Emericella nidulans ATP synthase subunit a (atp6)

This Recombinant Emericella nidulans ATP synthase subunit a (atp6) spans the amino acid sequence from region 9-256.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P00852

Expression Region

9-256

Origin

Emericella nidulans (Aspergillus nidulans)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPLDQFEIRDLFSLNANVLGNIHLSITNIGLYLSIGLLLTLGYHLLAANNKIIPNNWSIS QEAIYATVHSIVINQLNPTKGQLYFPFIYALFIFILVNNLIGMVPYSFASTSHFILTFSM SFTIVLGATFLGLQRHGLKFFSLFVPSGCPLGLLPLLVLIEFISYLSRNVSLGLRLAANI LSGHMLLSILSGFTYNIMTSGILFFFLGLIPLAFIIAFSGLELAIAFIQAQVFVVLTCSY IKDGLDLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
BNC940043-100 1x 100 µL

P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-100 1x 100 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1739), CF405S conjugate, 0.1mg/mL
BNC041739-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/1739), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF640R conjugate, 0.1mg/mL
BNC402659-500 1x 500 µL

Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF568 conjugate, 0.1mg/mL
BNC681448-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details