Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q899D2

Expression Region

1-249

Origin

Clostridium tetani

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPVLFELFGLKIYGYGAMIALGILAAVILLDKRSKKRGYNEDHIFNMAIVGIIGGILGG KLLYIIVDIKNIIDNPEILKDLGNGFVIYGAIIGGAISVYLYCKKKNWDVLKMLDLVVPS VALAQGFGRIGCFLAGCCYGKPTKLPIGVMFTNSPFAPSNIHLHPTQIYSSIFDFLLAFF LLWYSRKAEKSGRVFSLYVIIYGVGRVIVEFLRGDPRGNVSMLSTSQFISLFTIIIGIFV FNIDRFRKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc42bpg Mouse Gene Knockout Kit (CRISPR)
KN502976 1 Kit

Cdc42bpg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BATF2 (NM_138456) Human Recombinant Protein
TP760348 50 µg

BATF2 (NM_138456) Human Recombinant Protein

Sign In for Pricing
View Details
Human FBXL5 activation kit by CRISPRa
GA108810 1 Kit

Human FBXL5 activation kit by CRISPRa

Sign In for Pricing
View Details
Thromboxane B2-SIL
TRC-T405602-5MG 5 mg

Thromboxane B2-SIL

Sign In for Pricing
View Details
CKMT2 (NM_001099736) Human Recombinant Protein
TP316991L 1 mg

CKMT2 (NM_001099736) Human Recombinant Protein

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-1203
BCBS-1203 1 Unit

Biological Safety Cabinet Class II BCBS-1203

Sign In for Pricing
View Details