Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q899D2

Expression Region

1-249

Origin

Clostridium tetani

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPVLFELFGLKIYGYGAMIALGILAAVILLDKRSKKRGYNEDHIFNMAIVGIIGGILGG KLLYIIVDIKNIIDNPEILKDLGNGFVIYGAIIGGAISVYLYCKKKNWDVLKMLDLVVPS VALAQGFGRIGCFLAGCCYGKPTKLPIGVMFTNSPFAPSNIHLHPTQIYSSIFDFLLAFF LLWYSRKAEKSGRVFSLYVIIYGVGRVIVEFLRGDPRGNVSMLSTSQFISLFTIIIGIFV FNIDRFRKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bilirubin Microplate Assay Kit
RDSM150 100 Assays

Bilirubin Microplate Assay Kit

Sign In for Pricing
View Details
SLC25A12 Rabbit Polyclonal Antibody
TA381594 100 µL

SLC25A12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TXNDC15 Human Gene Knockout Kit (CRISPR)
KN400799 1 Kit

TXNDC15 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ERp19 (TXNDC12) Rabbit Polyclonal Antibody
TA366132 100 µL

ERp19 (TXNDC12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uck2 Mouse Gene Knockout Kit (CRISPR)
KN518642 1 Kit

Uck2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Flotillin-1 Antibody
RC-15375-01 50 μL

Recombinant Flotillin-1 Antibody

Sign In for Pricing
View Details