Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q899D2

Expression Region

1-249

Origin

Clostridium tetani

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPVLFELFGLKIYGYGAMIALGILAAVILLDKRSKKRGYNEDHIFNMAIVGIIGGILGG KLLYIIVDIKNIIDNPEILKDLGNGFVIYGAIIGGAISVYLYCKKKNWDVLKMLDLVVPS VALAQGFGRIGCFLAGCCYGKPTKLPIGVMFTNSPFAPSNIHLHPTQIYSSIFDFLLAFF LLWYSRKAEKSGRVFSLYVIIYGVGRVIVEFLRGDPRGNVSMLSTSQFISLFTIIIGIFV FNIDRFRKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL18 Antibody
KC-12351-01 50 μL

IL18 Antibody

Sign In for Pricing
View Details
IL18 Antibody
KC-12351-02 100 µL

IL18 Antibody

Sign In for Pricing
View Details
IL18 Antibody
KC-12351-03 1 mL

IL18 Antibody

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2603), CF640R conjugate, 0.1mg/mL
BNC402603-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2603), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IDH2 (NM_002168) Human Over-expression Lysate
LY400787 100 µg

IDH2 (NM_002168) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR561885 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details