Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML1171 (ML1171)

This Recombinant Uncharacterized protein ML1171 (ML1171) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Uncharacterized protein ML1171

UniProt

P53426

Expression Region

1-251

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPTGDWYKGGDEVGAPSACGGGSALMTLPEKNLGYKPETETNRRLRWMVGGVTILTFMA LLYLVELIDQLTRHSLDNNGIRLLKTDVLWGISFAPVLHANWQHLVANTIPLLVLGFLIA LAGLSRFIWVTAMVWIFGGSATWLIGNMGSSFGPTDHIGVSGLIFGWLAFLLVFGLFVRR GWDIIGCMVLFAYGGVLLGVMPVLGRCGGVSWQGHLCGAISGVVAAYLLSAPERKTRALK EAGTDSPRLKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAN1A1 ORF Vector (Human) (pORF)
ORF023258 1.0 µg DNA

MAN1A1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ARRDC3 siRNA (Rat)
MBS8216906-01 15 nmol

ARRDC3 siRNA (Rat)

Sign In for Pricing
View Details
ARRDC3 siRNA (Rat)
MBS8216906-02 30 nmol

ARRDC3 siRNA (Rat)

Sign In for Pricing
View Details
ARRDC3 siRNA (Rat)
MBS8216906-03 5x 30 nmol

ARRDC3 siRNA (Rat)

Sign In for Pricing
View Details
Olfactory receptor 9Q1 rabbit pAb Antibody
orb768093-01 50 μL

Olfactory receptor 9Q1 rabbit pAb Antibody

Sign In for Pricing
View Details
Olfactory receptor 9Q1 rabbit pAb Antibody
orb768093-02 100 µL

Olfactory receptor 9Q1 rabbit pAb Antibody

Sign In for Pricing
View Details