Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium avium Cobalamin synthase (cobS)

This Recombinant Mycobacterium avium Cobalamin synthase (cobS) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0QEZ8

Expression Region

1-251

Origin

Mycobacterium avium (strain 104)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRSLATAFAFGTVLPMPAGGRGPMGRGAMTALPVVGLALGALAAAVAWGGTVVFGRSSP LGGLLAVAALLLITRGLHIDGVADTADGLGCYGPPDRARAVMRDGSTGPFGVAAVVVVVM AQALAFSALAAGRPVPVGVAVAVFAGRVAAVLACRRTVPAAAGSSLGAAVAGSQPATVAA AWVAVLLGMSLVAGPRPWHGPVAVLLGLGCGAVLVRHCVRRFGGISGDVLGAAIELTATV SAVALAALVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FBX10 Antibody
NBP3-03304-20ul 20 µL

Rabbit Polyclonal FBX10 Antibody

Sign In for Pricing
View Details
ZNF300 Polyclonal Antibody
MBS2562286-01 0.02 mL

ZNF300 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF300 Polyclonal Antibody
MBS2562286-02 0.06 mL

ZNF300 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF300 Polyclonal Antibody
MBS2562286-03 0.12 mL

ZNF300 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF300 Polyclonal Antibody
MBS2562286-04 0.2 mL

ZNF300 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF300 Polyclonal Antibody
MBS2562286-05 5x 0.2 mL

ZNF300 Polyclonal Antibody

Sign In for Pricing
View Details