Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q73YK6

Expression Region

1-251

Origin

Mycobacterium paratuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRSLATAFAFGTVLPVPAGGRGPMGRGAMTALPVVGLALGALAAAVAWGGAVVFGRSSP LGGLLAVAALLLITRGLHIDGVADTADGLGCYGPPDRARAVMRDGSTGPFGVAAVVVVVM AQALAFSALAAGRPVPVGVAVAVFAGRVAAVLACRRTVPAAAGSSLGATVAGSQPATVAA AWVAVLLGMSLVAGPRPWHGPVAVLLGLGCGGVLVRHCVRRFGGISGDVLGAAIELTATV SAVALAALVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR22 Protein Vector (Rat) (pPB-C-His)
PV271198 500 ng

GPR22 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ACVR1C siRNA (Rat)
CRR3555-01 15 nmol

ACVR1C siRNA (Rat)

Sign In for Pricing
View Details
ACVR1C siRNA (Rat)
CRR3555-02 30 nmol

ACVR1C siRNA (Rat)

Sign In for Pricing
View Details
MLK2, Recombinant, Human, GST-Tag (Mixed-Lineage Kinase 2, MAP3K10, MST) discontinued
500272 10 µg

MLK2, Recombinant, Human, GST-Tag (Mixed-Lineage Kinase 2, MAP3K10, MST) discontinued

Sign In for Pricing
View Details
Methyl cellulose (Viscosity:100000mPa.s)
E2934-50mg 50 mg

Methyl cellulose (Viscosity:100000mPa.s)

Sign In for Pricing
View Details
Anti-Human CSK Polyclonal Antibody
PHE31801 100 μg

Anti-Human CSK Polyclonal Antibody

Sign In for Pricing
View Details