Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium sp. ATP synthase subunit a (atpB)

This Recombinant Methylobacterium sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B0ULY1

Expression Region

1-251

Origin

Methylobacterium sp. (strain 4-46)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVKLDPIHQFELKPLVSFGHIGHQHIAFTQSALYMFAAVGIIALITLVATRQRALVPGR MQSLAEAFYEFIASTVHQSAGHGSERFVPLVFSLFMFVLVLNLFGMIPYAFTVTSHIIVT FMLALVVILTVVIYGFMAHGVHFLDLFVPPGVPGWLKPLIVAIEVVSFISRPISLSVRLF ANMLAGHIALKIFAGFVPALLAAGIWGILSPLPLALSVAITALEMLVAVLQAYVFATLTS IYLSDALHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMIGD1 siRNA (h)
sc-94146 10 µM

TMIGD1 siRNA (h)

Sign In for Pricing
View Details
IDLSRFYGHF
078-29 200 µg

IDLSRFYGHF

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. syringae Effector protein hopM1 (hopM1), partial
MBS1362949 Inquire

Recombinant Pseudomonas syringae pv. syringae Effector protein hopM1 (hopM1), partial

Sign In for Pricing
View Details
EAP30 Rabbit Polyclonal Antibody
orb668208-01 30 µL

EAP30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EAP30 Rabbit Polyclonal Antibody
orb668208-02 50 μL

EAP30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EAP30 Rabbit Polyclonal Antibody
orb668208-03 100 µL

EAP30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details