Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium sp. ATP synthase subunit a (atpB)

This Recombinant Methylobacterium sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B0ULY1

Expression Region

1-251

Origin

Methylobacterium sp. (strain 4-46)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVKLDPIHQFELKPLVSFGHIGHQHIAFTQSALYMFAAVGIIALITLVATRQRALVPGR MQSLAEAFYEFIASTVHQSAGHGSERFVPLVFSLFMFVLVLNLFGMIPYAFTVTSHIIVT FMLALVVILTVVIYGFMAHGVHFLDLFVPPGVPGWLKPLIVAIEVVSFISRPISLSVRLF ANMLAGHIALKIFAGFVPALLAAGIWGILSPLPLALSVAITALEMLVAVLQAYVFATLTS IYLSDALHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial Amidoxime-Reducing Component 1 (MTARC1) Antibody
abx339575-01 50 µL

Mitochondrial Amidoxime-Reducing Component 1 (MTARC1) Antibody

Sign In for Pricing
View Details
Mitochondrial Amidoxime-Reducing Component 1 (MTARC1) Antibody
abx339575-02 100 µL

Mitochondrial Amidoxime-Reducing Component 1 (MTARC1) Antibody

Sign In for Pricing
View Details
Human CD226 (Cluster Of Differentiation 226) Microsample ELISA Kit
ELK3877MS-01 48 Tests

Human CD226 (Cluster Of Differentiation 226) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CD226 (Cluster Of Differentiation 226) Microsample ELISA Kit
ELK3877MS-02 96 Tests

Human CD226 (Cluster Of Differentiation 226) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CD226 (Cluster Of Differentiation 226) Microsample ELISA Kit
ELK3877MS-03 5x 96 Tests

Human CD226 (Cluster Of Differentiation 226) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse Caspase 14 (CASP14) ELISA Kit
abx255240-01 96 Tests

Mouse Caspase 14 (CASP14) ELISA Kit

Sign In for Pricing
View Details