Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium sp. ATP synthase subunit a (atpB)

This Recombinant Methylobacterium sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B0ULY1

Expression Region

1-251

Origin

Methylobacterium sp. (strain 4-46)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVKLDPIHQFELKPLVSFGHIGHQHIAFTQSALYMFAAVGIIALITLVATRQRALVPGR MQSLAEAFYEFIASTVHQSAGHGSERFVPLVFSLFMFVLVLNLFGMIPYAFTVTSHIIVT FMLALVVILTVVIYGFMAHGVHFLDLFVPPGVPGWLKPLIVAIEVVSFISRPISLSVRLF ANMLAGHIALKIFAGFVPALLAAGIWGILSPLPLALSVAITALEMLVAVLQAYVFATLTS IYLSDALHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GDAP1 Antibody
A03114 100 µL

Anti-GDAP1 Antibody

Sign In for Pricing
View Details
Mucic Acid
BUP18974 1 g

Mucic Acid

Sign In for Pricing
View Details
Scramblase 1 Recombinant Antibody, PE Conjugated
bsm-62122R-PE-01 20 µL

Scramblase 1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Scramblase 1 Recombinant Antibody, PE Conjugated
bsm-62122R-PE-02 100 µL

Scramblase 1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
ATE1 Polyclonal Antibody
E11-200458 100 µg -100 µL

ATE1 Polyclonal Antibody

Sign In for Pricing
View Details
Olr51 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV634999 1.0 µg DNA

Olr51 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details