Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium kluyveri Cobalamin synthase (cobS)

This Recombinant Clostridium kluyveri Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5N2J8

Expression Region

1-252

Origin

Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKELLNDFFLILQLLTRIPVNRNLLCRRENFRRGASFMPLVGVIVGGIQWIIYKLCIIIF SLNVSIVIVILAGIVLTGALHVDGLGDMCDGFFSFKEKGKIIEIMKDSRIGTYACLAIII DILLKYSFFCSIVPSFSLIIIIAPVMSRFSIVFIAFIGKPAKSTGSGNLFVENIGKWQLF WAAFITVITLFFLMNMNFIYVIILIFAGLFMSFLFNVFCNRKAGGLTGDLLGANNEIVEI LTMVMLCVIITK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal alpha-2B Adrenergic R/ADRA2B Antibody (491613) [PerCP]
FAB10324C 0.1 mL

Mouse Monoclonal alpha-2B Adrenergic R/ADRA2B Antibody (491613) [PerCP]

Sign In for Pricing
View Details
SNORD13 sgRNA CRISPR Lentivector (Human) (Target 2)
K2224603 1.0 µg DNA

SNORD13 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
WBP1 Blocking Peptide (C-Term)
MBS9230505-01 0.5 mg

WBP1 Blocking Peptide (C-Term)

Sign In for Pricing
View Details
WBP1 Blocking Peptide (C-Term)
MBS9230505-02 5x 0.5 mg

WBP1 Blocking Peptide (C-Term)

Sign In for Pricing
View Details
1,6-Dehydro tramadol discontinued
271364-01 1 mg

1,6-Dehydro tramadol discontinued

Sign In for Pricing
View Details
1,6-Dehydro tramadol discontinued
271364-02 2 mg

1,6-Dehydro tramadol discontinued

Sign In for Pricing
View Details