Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium beijerinckii Cobalamin synthase (cobS)

This Recombinant Clostridium beijerinckii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A6LSW5

Expression Region

1-252

Origin

Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLYKGFIMALSMFTILPTPYVEWDDDGVKNMMKFYPLIGLIIGVLWSIIYYLASILNA SIILKSSIITIVPFIITGMLHLDGFMDVCDAILSRRSKEEKLRILKDSATGAFAVIPLVI LFFLQFGGVYSILEKNSSLYTLILIPIISRSVVAYYLLSRATIKESTLGTYFKKGTNVYD KLIMIITLIITLIISVILLNIYGIILVLLMSLGIKLSVEKCRKEFGGISGDVAGFALVIG EVVGILILGIIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psat1 Mouse Gene Knockout Kit (CRISPR)
KN514065 1 Kit

Psat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl x (BCL2L1) Human Knockdown Lysate
LY300070 100 µg

Bcl x (BCL2L1) Human Knockdown Lysate

Sign In for Pricing
View Details
MIR6511a-2 Human qPCR Primer Pair (MI0023564)
HP301301 200 Reactions

MIR6511a-2 Human qPCR Primer Pair (MI0023564)

Sign In for Pricing
View Details
Auxin response factor Mouse Monoclonal Antibody [14D1]
EM1901-05 100 µL

Auxin response factor Mouse Monoclonal Antibody [14D1]

Sign In for Pricing
View Details
Rilmazafone Hydrochloride
TRC-R509715-2.5MG 2.5 mg

Rilmazafone Hydrochloride

Sign In for Pricing
View Details
SMO Antibody
8G743-AAT 50 µg

SMO Antibody

Sign In for Pricing
View Details