Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium beijerinckii Cobalamin synthase (cobS)

This Recombinant Clostridium beijerinckii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A6LSW5

Expression Region

1-252

Origin

Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKLYKGFIMALSMFTILPTPYVEWDDDGVKNMMKFYPLIGLIIGVLWSIIYYLASILNA SIILKSSIITIVPFIITGMLHLDGFMDVCDAILSRRSKEEKLRILKDSATGAFAVIPLVI LFFLQFGGVYSILEKNSSLYTLILIPIISRSVVAYYLLSRATIKESTLGTYFKKGTNVYD KLIMIITLIITLIISVILLNIYGIILVLLMSLGIKLSVEKCRKEFGGISGDVAGFALVIG EVVGILILGIIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Romo1 (NM_025946) AAV Particle
MR215929A1V 250 µL

Mouse Romo1 (NM_025946) AAV Particle

Sign In for Pricing
View Details
PPIG Rabbit Polyclonal Antibody (Fluoro550)
orb3129156 100 µg

PPIG Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
GPR80 CRISPR Activation Plasmid (m2)
sc-433675-ACT-2 20 µg

GPR80 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Monoclonal CCL16/HCC-4/LEC Antibody (013) [PerCP]
NBP2-89529PCP 0.1 mL

Rabbit Monoclonal CCL16/HCC-4/LEC Antibody (013) [PerCP]

Sign In for Pricing
View Details
C7ORF50 Adenovirus (Human)
14694051 1.0 mL

C7ORF50 Adenovirus (Human)

Sign In for Pricing
View Details
PDE1A CRISPR/Cas9 KO Plasmid (m)
sc-422156 20 µg

PDE1A CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details