Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B2TPF2

Expression Region

1-252

Origin

Clostridium botulinum (strain Eklund 17B / Type B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLFKGLMMSLSMFTIIPMPYVEWDEDGAKNMMKCYPIIGLIVGCVWFLGYKLINYLNI SIVLKSALIMIIPFIITGMLHLDGFMDVCDAILSRRDKEEKLRILKDSTTGAFSVISVII LFFIQFGAVHSFLEYNKNPYILMFLPIISRNIVAYFFITIITIKESTLGSYFTKGTNIKD KVILILELALVCILFGIILGYIGIVILLIVTVAISLCVKKCINEFGGISGDVAGFSLVVG ELVGLFSACLFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LBX2 shRNA (UAS) - Lentiviral human LBX2 shRNA (UAS, RFP) plasmid
GTR15084217 1 Vial

Lentiviral human LBX2 shRNA (UAS) - Lentiviral human LBX2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Elgemtumab ELISA Kit
KDD48401 96 Tests

Elgemtumab ELISA Kit

Sign In for Pricing
View Details
Livin/BIRC7 Rabbit Polyclonal Antibody
orb312086 100 µg

Livin/BIRC7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYP4B1, ID (Cytochrome P450 4B1, CYPIVB1, Cytochrome P450-HP) (MaxLight 550)
MBS6471708-01 0.1 mL

CYP4B1, ID (Cytochrome P450 4B1, CYPIVB1, Cytochrome P450-HP) (MaxLight 550)

Sign In for Pricing
View Details
CYP4B1, ID (Cytochrome P450 4B1, CYPIVB1, Cytochrome P450-HP) (MaxLight 550)
MBS6471708-02 5x 0.1 mL

CYP4B1, ID (Cytochrome P450 4B1, CYPIVB1, Cytochrome P450-HP) (MaxLight 550)

Sign In for Pricing
View Details
Smad1/5/9 Polyclonal Antibody
MBS9245230-01 0.1 mL

Smad1/5/9 Polyclonal Antibody

Sign In for Pricing
View Details