Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B2TPF2

Expression Region

1-252

Origin

Clostridium botulinum (strain Eklund 17B / Type B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLFKGLMMSLSMFTIIPMPYVEWDEDGAKNMMKCYPIIGLIVGCVWFLGYKLINYLNI SIVLKSALIMIIPFIITGMLHLDGFMDVCDAILSRRDKEEKLRILKDSTTGAFSVISVII LFFIQFGAVHSFLEYNKNPYILMFLPIISRNIVAYFFITIITIKESTLGSYFTKGTNIKD KVILILELALVCILFGIILGYIGIVILLIVTVAISLCVKKCINEFGGISGDVAGFSLVVG ELVGLFSACLFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CISH Recombinant Protein (Human)
RP007171 100 µg

CISH Recombinant Protein (Human)

Sign In for Pricing
View Details
S. pombe Smc3 (Nter) Recombinant Protein
PX-P1153-01 50 µg

S. pombe Smc3 (Nter) Recombinant Protein

Sign In for Pricing
View Details
S. pombe Smc3 (Nter) Recombinant Protein
PX-P1153-02 100 µg

S. pombe Smc3 (Nter) Recombinant Protein

Sign In for Pricing
View Details
S. pombe Smc3 (Nter) Recombinant Protein
PX-P1153-03 1 mg

S. pombe Smc3 (Nter) Recombinant Protein

Sign In for Pricing
View Details
ZNF320 (NM_207333) Human Over-expression Lysate
LS162967-20ug 20 µg

ZNF320 (NM_207333) Human Over-expression Lysate

Sign In for Pricing
View Details
1- (2-Pyridinyl) benzotriazole-15N3
HY-W740506-01 2.5 mg

1- (2-Pyridinyl) benzotriazole-15N3

Sign In for Pricing
View Details