Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B2UXE0

Expression Region

1-252

Origin

Clostridium botulinum (strain Alaska E43 / Type E3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNLFKGLMMSLSMFTIIPMPYVEWDEDGAKNMMKCYPIIGLIVGCVWFLGYKLINYLNI SIVLKSALIMIIPFIITGMLHLDGFMDVCDAILSRRDKEEKLRILKDSTTGAFSVISVII LFFIQFGAVHSFLEYNKNPYILMFLPIISRNIVAYFFITIITIKESTLGSYFTKGTNIKD KVILILELALVCILFGSILGYIGIAILLIVAVAISLCVKKCFKEFGGISGDVAGFSLVVG EIVGLFSACLFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-5A-dependent Ribonuclease, Recombinant, Human, aa1-741, GST-Tag
583377-01 20 µg

2-5A-dependent Ribonuclease, Recombinant, Human, aa1-741, GST-Tag

Sign In for Pricing
View Details
2-5A-dependent Ribonuclease, Recombinant, Human, aa1-741, GST-Tag
583377-02 100 µg

2-5A-dependent Ribonuclease, Recombinant, Human, aa1-741, GST-Tag

Sign In for Pricing
View Details
Mmu-miR-6981-3p miRNA Inhibitor
orb1869488-01 10 nmol

Mmu-miR-6981-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-6981-3p miRNA Inhibitor
orb1869488-02 20 nmol

Mmu-miR-6981-3p miRNA Inhibitor

Sign In for Pricing
View Details
At4g27745 Antibody
orb796580 2 mg

At4g27745 Antibody

Sign In for Pricing
View Details
Human NTRK2 (Neurotrophic Tyrosine Kinase Receptor Type 2) Quick ELISA Kit
orb2568058-01 48 Tests

Human NTRK2 (Neurotrophic Tyrosine Kinase Receptor Type 2) Quick ELISA Kit

Sign In for Pricing
View Details