Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium kluyveri Cobalamin synthase (cobS)

This Recombinant Clostridium kluyveri Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B9E675

Expression Region

1-252

Origin

Clostridium kluyveri (strain NBRC 12016)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKELLNDFFLILQLLTRIPVNRNLLCRRENFRRGASFMPLVGVIVGGIQWIIYKLCIIIF SLNVSIVIVILAGIVLTGALHVDGLGDMCDGFFSFKEKGKIIEIMKDSRIGTYACLAIII DILLKYSFFCSIVPSFSLIIIIAPVMSRFSIVFIAFIGKPAKSTGSGNLFVENIGKWQLF WAAFITVITLFFLMNMNFIYVIILIFAGLFMSFLFNVFCNRKAGGLTGDLLGANNEIVEI LTMVMLCVIITK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
E-AB-F1242S-01 20 Tests

Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
E-AB-F1242S-02 100 Tests

Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]
E-AB-F1242S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Recombinant Rat IL6RA/CD126 Protein (Fc tag, ECD)
PKSR030143 100 µg

Recombinant Rat IL6RA/CD126 Protein (Fc tag, ECD)

Sign In for Pricing
View Details
ABHD10 Rabbit Polyclonal Antibody
TA370548 100 µL

ABHD10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TLR2 antibody
FNab09836 100 µg

TLR2 antibody

Sign In for Pricing
View Details