Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium kluyveri Cobalamin synthase (cobS)

This Recombinant Clostridium kluyveri Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B9E675

Expression Region

1-252

Origin

Clostridium kluyveri (strain NBRC 12016)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKELLNDFFLILQLLTRIPVNRNLLCRRENFRRGASFMPLVGVIVGGIQWIIYKLCIIIF SLNVSIVIVILAGIVLTGALHVDGLGDMCDGFFSFKEKGKIIEIMKDSRIGTYACLAIII DILLKYSFFCSIVPSFSLIIIIAPVMSRFSIVFIAFIGKPAKSTGSGNLFVENIGKWQLF WAAFITVITLFFLMNMNFIYVIILIFAGLFMSFLFNVFCNRKAGGLTGDLLGANNEIVEI LTMVMLCVIITK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gastrin Releasing Peptide (GRP) activation kit by CRISPRa
GA101977 1 Kit

Human Gastrin Releasing Peptide (GRP) activation kit by CRISPRa

Sign In for Pricing
View Details
FAM228B Human Gene Knockout Kit (CRISPR)
KN427034 1 Kit

FAM228B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM39B Human Gene Knockout Kit (CRISPR)
KN421912 1 Kit

TMEM39B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Enterovirus D68 (EV-D68) (strain Fermon) VP1 Protein (Fc Tag)
PKSV030169 100 µg

Recombinant Enterovirus D68 (EV-D68) (strain Fermon) VP1 Protein (Fc Tag)

Sign In for Pricing
View Details
ATP13A2 Human Gene Knockout Kit (CRISPR)
KN215270 1 Kit

ATP13A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Leucine Rich Repeat In FLII Interacting Protein 1 (LRRFIP1) ELISA Kit
RD-LRRFIP1-Hu-01 96 Tests

Human Leucine Rich Repeat In FLII Interacting Protein 1 (LRRFIP1) ELISA Kit

Sign In for Pricing
View Details