Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium kluyveri Cobalamin synthase (cobS)

This Recombinant Clostridium kluyveri Cobalamin synthase (cobS) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B9E675

Expression Region

1-252

Origin

Clostridium kluyveri (strain NBRC 12016)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKELLNDFFLILQLLTRIPVNRNLLCRRENFRRGASFMPLVGVIVGGIQWIIYKLCIIIF SLNVSIVIVILAGIVLTGALHVDGLGDMCDGFFSFKEKGKIIEIMKDSRIGTYACLAIII DILLKYSFFCSIVPSFSLIIIIAPVMSRFSIVFIAFIGKPAKSTGSGNLFVENIGKWQLF WAAFITVITLFFLMNMNFIYVIILIFAGLFMSFLFNVFCNRKAGGLTGDLLGANNEIVEI LTMVMLCVIITK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmp3 Mouse Gene Knockout Kit (CRISPR)
KN310182 1 Kit

Mmp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lymph node
CB510228 1 Block

Frozen Tissue Blocks, Lymph node

Sign In for Pricing
View Details
CKI-α Antibody
8C10638-AAT 50 µg

CKI-α Antibody

Sign In for Pricing
View Details
Human FEM 1C (FEM1C) activation kit by CRISPRa
GA111279 1 Kit

Human FEM 1C (FEM1C) activation kit by CRISPRa

Sign In for Pricing
View Details
Rb (RB1) Rabbit Polyclonal Antibody
AP06302PU-N 100 µg

Rb (RB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRAF Antibody
OC-1512-01 50 μL

BRAF Antibody

Sign In for Pricing
View Details