Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Mannose-P-dolichol utilization defect 1 protein homolog (CG3792)

This Recombinant Drosophila melanogaster Mannose-P-dolichol utilization defect 1 protein homolog (CG3792) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Mannose-P-dolichol utilization defect 1 protein homolog

UniProt

Q9VMW8

Expression Region

1-252

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLIRQGALFLMSEKCYDNYFLYHNFLDVPCFKALLSKGLGLAIIAGSVLVKVPQVLKI LNSKSGEGINIVGVVLDLLAISFHLSYNFMHGYPFSAWGDSTFLAIQTVTIAVLVLFFNG RKAQSGLFLVGYVVLMYVLNSGLTPMSVLFTIQSCNIPILLVGKLSQAYTNYQAGSTGQL SAATVIMMFAGSVARIFTSIQETGDFMIILTFIASTFANSVILGQLIYYWNKPAGVKVKD SKAKKPKTKKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-100 1x 100 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-500 1x 500 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-500 1x 500 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2603), CF594 conjugate, 0.1mg/mL
BNC942603-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2603), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details