Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha ATP synthase subunit a (ATP6)

This Recombinant Marchantia polymorpha ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P26853

Expression Region

1-252

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MACSPLEQFAIIQLIPIHIGNLYFSFTNSSLFMLLTISLVLLLVHFVTLNGGNLVPNAWQ SFVEMIYDFVLNLVNEQISGASSVKQRFFPLIYVTFTFLLFCNLIGMIPYSFTVTSHFII TLGLSFSLFIGITIVGFQTHGLHFFSILLPQGVPLPLAPFLVLLELISYCFRALSLGIRL FANMMAGHSLVKILSGFAWTMLSMGGILYLGQLAPFFIVFALTGLELGVAILQAYVFTIL LCIYLNDAINLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptophysin (Neuroendocrine Marker) (SYP/3551), CF488A conjugate, 0.1mg/mL
BNC883551-100 1x 100 µL

Synaptophysin (Neuroendocrine Marker) (SYP/3551), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PABPN1 Rabbit Monoclonal Antibody [Clone ID: 24GB365]
TA425126 100 µL

PABPN1 Rabbit Monoclonal Antibody [Clone ID: 24GB365]

Sign In for Pricing
View Details
DELE1 (NM_001142603) Human Over-expression Lysate
LC428204 20 µg

DELE1 (NM_001142603) Human Over-expression Lysate

Sign In for Pricing
View Details
PPAR gamma (PPARG) Human Gene Knockout Kit (CRISPR)
KN201538 1 Kit

PPAR gamma (PPARG) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS705648 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
CACNG1 Rabbit Polyclonal Antibody
TA374198 100 µL

CACNG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details