Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha ATP synthase subunit a (ATP6)

This Recombinant Marchantia polymorpha ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P26853

Expression Region

1-252

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MACSPLEQFAIIQLIPIHIGNLYFSFTNSSLFMLLTISLVLLLVHFVTLNGGNLVPNAWQ SFVEMIYDFVLNLVNEQISGASSVKQRFFPLIYVTFTFLLFCNLIGMIPYSFTVTSHFII TLGLSFSLFIGITIVGFQTHGLHFFSILLPQGVPLPLAPFLVLLELISYCFRALSLGIRL FANMMAGHSLVKILSGFAWTMLSMGGILYLGQLAPFFIVFALTGLELGVAILQAYVFTIL LCIYLNDAINLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycidyl Caprylate
TRC-G615520-1G 1 g

Glycidyl Caprylate

Sign In for Pricing
View Details
PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D9]
TA801592AM 100 µL

PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D9]

Sign In for Pricing
View Details
DGKA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G7]
TA504024AM 100 µL

DGKA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G7]

Sign In for Pricing
View Details
GNPDA2 Human Gene Knockout Kit (CRISPR)
KN402194 1 Kit

GNPDA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TFPI2 Recombinant Rabbit monoclonal Antibody
HA751560 100 µL

TFPI2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
P53 (BP53-12 + DO-7), CF594 conjugate, 0.1mg/mL
BNC940723-100 1x 100 µL

P53 (BP53-12 + DO-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details